A lightweight Python module to read and write FASTA sequence records
Project description
fastapy
A lightweight Python module to read and write sequence records in FASTA format.
The design was inspired by the utility of BioPython’s SeqIO, which supports many sequence formats. This repo focuses only on FASTA records. It is faster than BioPython, can handle compressed FASTA files (gzip, bzip2, zip), and has no Python package dependencies.
Requirements
Python >= 3.8
Installation
Use pip:
$ pip install fastapy
Alternatively, you can simply clone it and use it without installation.
Quick Start
Typical usage is to read a FASTA file and loop over the sequences record(s).
import fastapy
for record in fastapy.parse('test/test.fasta'):
print(record.id, len(record), record.seq[:10], record.desc)
Output:
NP_002433.1 362 METDAPQPGL RNA-binding protein Musashi homolog 1 [Homo sapiens]
ENO94161.1 79 MKLLISGLGP RRM domain-containing RNA-binding protein
sequence 292 MKLSKIALMM
Usage
This module contains the Record
class representing a FASTA sequence record and the parse()
function to read FASTA records from a file.
Record object
Record is an object that contains information on a FASTA sequence record, including id, description, and the sequence itself.
import fastapy
record = fastapy.Record(
id='NP_950171.2',
seq='MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFASICRKRQE',
desc='APITD1-CORT protein isoform 2 [Homo sapiens]'
)
print(record.id) # NP_950171.2
print(record.desc) # APITD1-CORT protein isoform 2 [Homo sapiens]
print(record.seq) # MEEEAE..
print(record.description) # >NP_950171.2 G APITD1-CORT protein isoform 2 [Homo sapiens]
print(len(record)) # 77
print('EEEA' in record) # True
By default, the sequence line is wrapped to 70 characters. You can provide the line length. Use zero (or None) for no wrapping.
print(record)
# >NP_950171.2 APITD1-CORT protein isoform 2 [Homo sapiens]
# MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFAS
# ICRKRQE
print(record.format(wrap=30))
# >NP_001382951.1 G protein subunit gamma 5 [Homo sapiens]
# MEEEAETEEQQRFSYQQRLKAAVHYTVGCL
# CEEVALDKEMQFSKQTIAAISELTFRQCEN
# FAKDLEMFASICRKRQE
print(record.format(wrap=None))
# >NP_950171.2 APITD1-CORT protein isoform 2 [Homo sapiens]
# MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFASICRKRQE
parse
The parse()
function is a generator to read FASTA records as Record
objects one by one from a file (plain FASTA or compressed using gzip or bzip2). Because only one record is created at a time, very little memory is required.
import fastapy
for record in fastapy.parse('test/test.fasta.gz'):
print(record.id)
For some tasks you may need to have a reusable access to the records. For this purpose, you can use the built-in Python list()
function to turn the iterator into a list:
import fastapy
records = list(fastapy.parse('test/test.fasta.gz'))
print(records[0].id) # First record
print(records[-1].id) # Last record
Another common task is to index your records by sequence identifier. Use to_dict()
to turn a Record iterator (or list) into a dictionary.
import fastapy
records = fastapy.to_dict(fasta.parse('test/test.fasta.gz'))
print(records['NP_002433.1']) # Use any record id
read
If you want to read only a single record from a file, use the read()
function.
import fastapy
seq_record = fastapy.read('test/test.fasta')
print(seq_record.id) # NP_002433.1
Test
You can run tests to ensure that the module works as expected.
./test.py
License
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.