Skip to main content

Python interface to running command-line and web-based MHC binding predictors

Project description

Python interface to running command-line and web-based MHC binding predictors.

Example

from mhctools import NetMHCpan
# Run NetMHCpan for alleles HLA-A*01:01 and HLA-A*02:01
predictor = NetMHCpan(alleles=["A*02:01", "hla-a0101"])

# scan the short proteins 1L2Y and 1L3Y for epitopes
protein_sequences = {
  "1L2Y": "NLYIQWLKDGGPSSGRPPPS",
  "1L3Y": "ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA"
}

epitope_collection = predictor.predict(protein_sequences)

# flatten binding predictions into a Pandas DataFrame
df = epitope_collection.dataframe()

# epitope collection is sorted by percentile rank
# of binding predictions
strongest_predicted_binder = epitope_collection[0]

API

The following models are available in mhctools: * NetMHCpan: requires locally installed version of NetMHCpan * NetMHCcons: requires locally installed version of NetMHCcons * IedbMhcClass1: Uses IEDB’s REST API for class I binding predictions. * IedbMhcClass2: Uses IEDB’s REST API for class II binding predictions. * RandomBindingPredictor: Creates binding predictions with random IC50 and percentile rank values.

Every model is constructed with an alleles argument specifying the HLA type for which to make predictions. Predictions are generated by calling the predict method with a dictionary mapping sequence IDs or names to amino acid sequences.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

mhctools-0.1.1.tar.gz (22.0 kB view hashes)

Uploaded Source

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page